OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VTI1A (NM_145206) Human Mass Spec Standard

Be the first to review this product
SKU
PH313934
VTI1A MS Standard C13 and N15-labeled recombinant protein (NP_660207)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505824 VTI1A mouse monoclonal antibody, clone OTI1F4 (formerly 1F4) 100 ul
$447.00
LY407945 Transient overexpression lysate of vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A) (as WB positive control) 100 ug
$436.00

Other products for "VTI1A or NM_145206"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213934
Predicted MW 25 kDa
Protein Sequence
Protein Sequence
>RC213934 representing NM_145206
Red=Cloning site Green=Tags(s)

MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMY
SNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAV
ETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAI
TFSVRRH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660207
RefSeq Size 4401
RefSeq ORF 651
Synonyms MMDS3; MVti1; Vti1-rp2; VTI1RP2
Locus ID 143187
UniProt ID Q96AJ9
Cytogenetics 10q25.2
Summary The protein encoded by this gene is a member of the family of soluble N-ethylmaleimide-sensitive fusion protein-attachment protein receptors (SNAREs) that function in intracellular trafficking. This family member is involved in vesicular transport between endosomes and the trans-Golgi network. It is a vesicle-associated SNARE (v-SNARE) that interacts with target membrane SNAREs (t-SNAREs). Polymorphisms in this gene have been associated with binocular function, and also with susceptibility to colorectal and lung cancers. A recurrent rearrangement has been found between this gene and the transcription factor 7-like 2 (TCF7L2) gene in colorectal cancers. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2015
Protein Families Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VTI1A" proteins (3)
SKU Description Size Price
LC407945 Lyophilized VTI1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407945 Transient overexpression lysate of vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A) (as WB positive control) 100 ug
$436.00
TP313934 Recombinant protein of human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products