VTI1A (NM_145206) Human Tagged ORF Clone

SKU
RC213934
VTI1A (Myc-DDK-tagged)-Human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol VTI1A
Synonyms MMDS3; MVti1; Vti1-rp2; VTI1RP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213934 representing NM_145206
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTCCGACTTCGAAGGTTACGAGCAGGACTTCGCGGTGCTCACTGCAGAGATCACCAGCAAGATTG
CGAGGGTCCCACGACTCCCGCCTGATGAAAAGAAACAGATGGTTGCAAATGTGGAGAAACAGCTTGAAGA
AGCGAAAGAACTGCTTGAACAGATGGATTTGGAAGTCCGAGAGATACCACCCCAAAGTCGAGGGATGTAC
AGCAACAGAATGAGAAGCTACAAACAAGAAATGGGAAAACTCGAAACAGATTTTAAAAGGTCACGGATCG
CCTACAGTGACGAAGTACGGAATGAGCTCCTGGGGGATGATGGGAATTCCTCAGAGAACCAGAGGGCACA
TCTGCTCGATAACACAGAGAGGCTGGAAAGGTCATCTCGGAGACTAGAGGCTGGATACCAAATAGCAGTG
GAAACCGAGCAAATTGGTCAGGAGATGTTGGAAAACCTTAGTCATGACAGAGAAAAGATACAGCGAGCAC
GTGAAAGACTTCGGGAAACAGATGCTAATTTGGGAAAAAGCTCCAGGATTCTGACAGGGATGTTGCGAAG
AATCATCCAGAACCGCATCCTGCTCGTCATCCTAGGGATCATCGTGGTCATCACCATCCTGATGGCGATC
ACTTTTTCTGTCAGAAGACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213934 representing NM_145206
Red=Cloning site Green=Tags(s)

MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMY
SNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAV
ETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAI
TFSVRRH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145206
ORF Size 651 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145206.4
RefSeq Size 4401 bp
RefSeq ORF 654 bp
Locus ID 143187
UniProt ID Q96AJ9
Cytogenetics 10q25.2
Domains V-SNARE
Protein Families Transmembrane
Protein Pathways SNARE interactions in vesicular transport
MW 25 kDa
Summary The protein encoded by this gene is a member of the family of soluble N-ethylmaleimide-sensitive fusion protein-attachment protein receptors (SNAREs) that function in intracellular trafficking. This family member is involved in vesicular transport between endosomes and the trans-Golgi network. It is a vesicle-associated SNARE (v-SNARE) that interacts with target membrane SNAREs (t-SNAREs). Polymorphisms in this gene have been associated with binocular function, and also with susceptibility to colorectal and lung cancers. A recurrent rearrangement has been found between this gene and the transcription factor 7-like 2 (TCF7L2) gene in colorectal cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:VTI1A (NM_145206) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213934L1 Lenti ORF clone of Human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A), Myc-DDK-tagged 10 ug
$600.00
RC213934L2 Lenti ORF clone of Human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A), mGFP tagged 10 ug
$600.00
RC213934L3 Lenti ORF clone of Human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A), Myc-DDK-tagged 10 ug
$600.00
RC213934L4 Lenti ORF clone of Human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A), mGFP tagged 10 ug
$600.00
RG213934 VTI1A (tGFP-tagged) - Human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC309124 VTI1A (untagged)-Human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A) 10 ug
$300.00
SC317321 VTI1A (untagged)-Human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.