FOXD4 (NM_207305) Human Mass Spec Standard

CAT#: PH313792

FOXD4 MS Standard C13 and N15-labeled recombinant protein (NP_997188)

Product Images

Coomassie blue staining of purified FOXD4 protein (Cat# TP313792). The protein was produced from HEK293T cells transfected with FOXD4 cDNA clone (Cat# RC213792) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213792
• Predicted MW: 47.3 kDa
• Protein Sequence:
  Sequence Link

  >RC213792 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEEEAASQQFLEQSLQPGLQVARWGGVALPREHI
  EGGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPY
  YRRKFPAWQNSIRHNLSLNDCFVKIPREPGRPGKGNYWSLDPASQDMFDNGSFLRRRKRFQRHQPTPGAH
  LPHPFPLPAAHAALHNPRPGPLLGAPAPPQPVPGAYPNTGPGRRPYALLHPHPPRYLLLSAPAYAGAPKK
  AEGADLATPAPFPCCSPHLVLSLGRRARVWRRHREADASLSALRVSCKGSGERVQGLRRVCPRPRGATAP
  CSSDRQACRTILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTS
  PVFLVSPTPSSLAESAGPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_997188
• RefSeq Size: 2204
• RefSeq ORF: 1317
• Synonyms: FKHL9; FOXD4A; FREAC-5; FREAC5
• Locus ID: 2298
• UniProt ID: Q12950
• Cytogenetics: 9p24.3
• Summary: This gene encodes a member of the forkhead/winged helix-box (FOX) family of transcription factors. FOX transcription factors play critical roles in the regulation of multiple processes including metabolism, cell proliferation and gene expression during ontogenesis. Mutations in this gene are associated with a complex phenotype consisting of dilated cardiomyopathy, obsessive-compulsive disorders, and suicidality. [provided by RefSeq, Mar 2012]
• Protein Families: Transcription Factors