OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCL 1 (CD302) (NM_014880) Human Mass Spec Standard

Be the first to review this product
SKU
PH313785
CD302 MS Standard C13 and N15-labeled recombinant protein (NP_055695)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA314992 Rabbit polyclonal anti-CD302 antibody
100 ul
$380.00
LY434014 Transient overexpression lysate of CD302 molecule (CD302), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "DCL 1 or NM_014880"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213785
Predicted MW 26 kDa
Protein Sequence
Protein Sequence
>RC213785 representing NM_014880
Red=Cloning site Green=Tags(s)

MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEE
ENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKK
GNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQ
SPYNEDCVLVVGEENEYPVQFD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055695
RefSeq Size 3740
RefSeq ORF 696
Synonyms BIMLEC; CLEC13A; DCL-1; DCL1
Locus ID 9936
UniProt ID Q8IX05
Cytogenetics 2q24.2
Summary CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis (Kato et al., 2007 PubMed 17947679).supplied by OMIM, Aug 2008
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCL 1" proteins (5)
SKU Description Size Price
LC402391 Lyophilized CD302 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434014 Lyophilized CD302 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402391 Transient overexpression lysate of CD302 molecule (CD302) (as WB positive control) 100 ug
$436.00
LY434014 Transient overexpression lysate of CD302 molecule (CD302), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP313785 Recombinant protein of human CD302 molecule (CD302), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products