OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OSBPL3 (NM_145322) Human Mass Spec Standard

Be the first to review this product
SKU
PH313784
OSBPL3 MS Standard C13 and N15-labeled recombinant protein (NP_663162)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA379509 OSBPL3 Rabbit polyclonal Antibody
100 ul
$410.00
LY407964 Transient overexpression lysate of oxysterol binding protein-like 3 (OSBPL3), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "OSBPL3 or NM_145322"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213784
Predicted MW 93.6 kDa
Protein Sequence
Protein Sequence
>RC213784 representing NM_145322
Red=Cloning site Green=Tags(s)

MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWH
KRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSK
LRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVP
LWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQVPKPFSGPVRLHSSNPNLSTL
DFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLK
NALSSENSRDENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNL
SNDLDNERQTLGPVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQ
RLCEELEYSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRAGSKPFNPVLGETYECIREDKGFQFFSE
QVSHHPPISACHAESRNFVFWQDVRWKNKFWGKSMEIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQ
RWIEHYGEIVIKNLHDDSCYCKVNFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSA
CVWRANPMPKGYEQYYSFTQFALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQR
ERRRVLEENHVEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_663162
RefSeq Size 6529
RefSeq ORF 2460
Synonyms ORP-3; ORP3; OSBP3
Locus ID 26031
UniProt ID Q9H4L5
Cytogenetics 7p15.3
Summary This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. The encoded protein is involved in the regulation of cell adhesion and organization of the actin cytoskeleton. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OSBPL3" proteins (9)
SKU Description Size Price
PH313732 OSBPL3 MS Standard C13 and N15-labeled recombinant protein (NP_663161) 10 ug
$3,360.00
LC407964 Lyophilized OSBPL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407966 Lyophilized OSBPL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414466 Lyophilized OSBPL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407964 Transient overexpression lysate of oxysterol binding protein-like 3 (OSBPL3), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY407966 Transient overexpression lysate of oxysterol binding protein-like 3 (OSBPL3), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY414466 Transient overexpression lysate of oxysterol binding protein-like 3 (OSBPL3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP313732 Recombinant protein of human oxysterol binding protein-like 3 (OSBPL3), transcript variant 3, 20 µg 20 ug
$737.00
TP313784 Recombinant protein of human oxysterol binding protein-like 3 (OSBPL3), transcript variant 4, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products