OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC90B (NM_021825) Human Mass Spec Standard

Be the first to review this product
SKU
PH313680
CCDC90B MS Standard C13 and N15-labeled recombinant protein (NP_068597)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411907 Transient overexpression lysate of coiled-coil domain containing 90B (CCDC90B) (as WB positive control) 100 ug
$436.00

Other products for "CCDC90B or NM_021825"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213680
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC213680 representing NM_021825
Red=Cloning site Green=Tags(s)

MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRREFFTTTTKEGYDRRPVDITPLEQRKLTFDTHALVQDL
ETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHLDAIRKDMVILEKSEFANLRAE
NEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETS
NKIDAEIASLKTLMESNKLETIRYLAASVFTCLAIALGFYRFWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068597
RefSeq Size 1585
RefSeq ORF 762
Synonyms MDS011; MDS025
Locus ID 60492
UniProt ID Q9GZT6
Cytogenetics 11q14.1
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC90B" proteins (3)
SKU Description Size Price
LC411907 Lyophilized CCDC90B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411907 Transient overexpression lysate of coiled-coil domain containing 90B (CCDC90B) (as WB positive control) 100 ug
$436.00
TP313680 Recombinant protein of human coiled-coil domain containing 90B (CCDC90B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products