OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GJA8 (NM_005267) Human Mass Spec Standard

Be the first to review this product
SKU
PH313469
GJA8 MS Standard C13 and N15-labeled recombinant protein (NP_005258)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350758 Rabbit Polyclonal Anti-GJA8 Antibody
100 ul
$205.00
LY417410 Transient overexpression lysate of gap junction protein, alpha 8, 50kDa (GJA8) (as WB positive control) 100 ug
$665.00

Other products for "GJA8 or NM_005267"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213469
Predicted MW 48 kDa
Protein Sequence
Protein Sequence
>RC213469 representing NM_005267
Red=Cloning site Green=Tags(s)

MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGCENVCYDEAF
PISHIRLWVLQIIFVSTPSLMYVGHAVHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKK
FRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPLYRCSRWPCPNVVDCFVSRPTEKTIFILFML
SVASVSLFLNVMELGHLGLKGIRSALKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFP
LTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKK
EEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLS
KASSRARSDDLTV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005258
RefSeq Size 1374
RefSeq ORF 1299
Synonyms CAE; CAE1; CTRCT1; CX50; CZP1; MP70
Locus ID 2703
UniProt ID P48165
Cytogenetics 1q21.2
Summary This gene encodes a transmembrane connexin protein that is necessary for lens growth and maturation of lens fiber cells. The encoded protein is a component of gap junction channels and functions in a calcium and pH-dependent manner. Mutations in this gene have been associated with zonular pulverulent cataracts, nuclear progressive cataracts, and cataract-microcornea syndrome. provided by RefSeq, Dec 2009
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GJA8" proteins (3)
SKU Description Size Price
LC417410 Lyophilized GJA8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417410 Transient overexpression lysate of gap junction protein, alpha 8, 50kDa (GJA8) (as WB positive control) 100 ug
$665.00
TP313469 Recombinant protein of human gap junction protein, alpha 8, 50kDa (GJA8), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products