OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C2orf88 (NM_032321) Human Mass Spec Standard

Be the first to review this product
SKU
PH313211
C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_115697)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403155 Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "C2orf88 or NM_032321"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213211
Predicted MW 10.8 kDa
Protein Sequence
Protein Sequence
>RC213211 representing NM_032321
Red=Cloning site Green=Tags(s)

MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDIL
CDALQQWACNNIKYHDIPYIESEGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115697
RefSeq Size 705
RefSeq ORF 285
Synonyms smAKAP
Locus ID 84281
UniProt ID Q9BSF0
Cytogenetics 2q32.2
Summary Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C2orf88" proteins (15)
SKU Description Size Price
PH302987 C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035984) 10 ug
$3,360.00
PH313362 C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035985) 10 ug
$3,360.00
PH324360 C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035986) 10 ug
$3,360.00
LC403155 Lyophilized C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420957 Lyophilized C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420958 Lyophilized C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420959 Lyophilized C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403155 Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY420957 Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420958 Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY420959 Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302987 Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 1, 20 µg 20 ug
$867.00
TP313211 Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 4, 20 µg 20 ug
$867.00
TP313362 Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 3, 20 µg 20 ug
$867.00
TP324360 Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products