OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UFD1 (NM_001035247) Human Mass Spec Standard

Be the first to review this product
SKU
PH313180
UFD1L MS Standard C13 and N15-labeled recombinant protein (NP_001030324)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA804317 UFD1L mouse monoclonal antibody, clone OTI8G6 (formerly 8G6) 100 ul
$447.00
LY417150 Transient overexpression lysate of ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "UFD1 or NM_001035247"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213180
Predicted MW 33.32 kDa
Protein Sequence
Protein Sequence
>RC213180 representing NM_001035247
Red=Cloning site Green=Tags(s)

MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKSRLNITYPMLFKLTNKNSDRMTHCG
VLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFAC
LTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEESTEGEADHSGYAG
ELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFV
AFSGEGQSLRKKGRKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001030324
RefSeq Size 1501
RefSeq ORF 888
Synonyms UFD1L
Locus ID 7353
UniProt ID Q92890
Cytogenetics 22q11.21
Summary The protein encoded by this gene forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitinated proteins. In addition, this complex controls the disassembly of the mitotic spindle and the formation of a closed nuclear envelope after mitosis. Mutations in this gene have been associated with Catch 22 syndrome as well as cardiac and craniofacial defects. Alternative splicing results in multiple transcript variants encoding different isoforms. A related pseudogene has been identified on chromosome 18. provided by RefSeq, Jun 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UFD1" proteins (7)
SKU Description Size Price
PH302989 UFD1L MS Standard C13 and N15-labeled recombinant protein (NP_005650) 10 ug
$3,360.00
LC417150 Lyophilized UFD1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422127 Lyophilized UFD1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417150 Transient overexpression lysate of ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422127 Transient overexpression lysate of ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302989 Recombinant protein of human ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 1, 20 µg 20 ug
$867.00
TP313180 Recombinant protein of human ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products