OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Midkine (MDK) (NM_002391) Human Mass Spec Standard

Be the first to review this product
SKU
PH313133
MDK MS Standard C13 and N15-labeled recombinant protein (NP_002382)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA807679 MDK mouse monoclonal antibody, clone OTI6C8 (formerly 6C8) 100 ul
$447.00
LY419358 Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "Midkine or NM_002391"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213133
Predicted MW 15.4 kDa
Protein Sequence
Protein Sequence
>RC213133 representing NM_002391
Red=Cloning site Green=Tags(s)

MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC
RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK
GKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002382
RefSeq Size 866
RefSeq ORF 429
Synonyms ARAP; MK; NEGF2
Locus ID 4192
UniProt ID P21741
Cytogenetics 11p11.2
Summary This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. provided by RefSeq, Jul 2012
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Midkine" proteins (13)
SKU Description Size Price
PH303995 MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012333) 10 ug
$3,360.00
PH321818 MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012334) 10 ug
$3,360.00
LC419358 Lyophilized MDK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423327 Lyophilized MDK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423328 Lyophilized MDK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425316 Lyophilized MDK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419358 Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY423327 Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423328 Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY425316 Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303995 Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2, 20 µg 20 ug
$867.00
TP313133 Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3, 20 µg 20 ug
$867.00
TP321818 Purified recombinant protein of Homo sapiens midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products