Midkine (MDK) (NM_001012333) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC203995] |
Predicted MW | 15.6 kDa |
Protein Sequence |
Protein Sequence
>RC203995 protein sequence
Red=Cloning site Green=Tags(s) MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK GKD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001012333 |
RefSeq Size | 969 |
RefSeq ORF | 429 |
Synonyms | ARAP; MK; NEGF2 |
Locus ID | 4192 |
UniProt ID | P21741 |
Cytogenetics | 11p11.2 |
Summary | This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313133 | MDK MS Standard C13 and N15-labeled recombinant protein (NP_002382) | 10 ug |
$3,255.00
|
|
PH321818 | MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012334) | 10 ug |
$3,255.00
|
|
LC419358 | MDK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423327 | MDK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423328 | MDK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425316 | MDK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419358 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3 | 100 ug |
$436.00
|
|
LY423327 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2 | 100 ug |
$436.00
|
|
LY423328 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 | 100 ug |
$436.00
|
|
LY425316 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 | 100 ug |
$436.00
|
|
TP303995 | Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP313133 | Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP321818 | Purified recombinant protein of Homo sapiens midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.