OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RIPPLY3 (NM_018962) Human Mass Spec Standard

Be the first to review this product
SKU
PH313078
DSCR6 MS Standard C13 and N15-labeled recombinant protein (NP_061835)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY412850 Transient overexpression lysate of Down syndrome critical region gene 6 (DSCR6) (as WB positive control) 100 ug
$436.00

Other products for "RIPPLY3 or NM_018962"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213078
Predicted MW 20.2 kDa
Protein Sequence
Protein Sequence
>RC213078 representing NM_018962
Red=Cloning site Green=Tags(s)

MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSK
GAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEV
GGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061835
RefSeq Size 2262
RefSeq ORF 570
Synonyms DSCR6
Locus ID 53820
UniProt ID P57055
Cytogenetics 21q22.13
Summary Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of TBX1. Plays a role in the development of the pharyngeal apparatus and derivatives (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RIPPLY3" proteins (3)
SKU Description Size Price
LC412850 Lyophilized RIPPLY3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412850 Transient overexpression lysate of Down syndrome critical region gene 6 (DSCR6) (as WB positive control) 100 ug
$436.00
TP313078 Recombinant protein of human Down syndrome critical region gene 6 (DSCR6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products