RASSF7 (NM_003475) Human Mass Spec Standard

CAT#: PH312844

RASSF7 MS Standard C13 and N15-labeled recombinant protein (NP_003466)

Product Images

Coomassie blue staining of purified RASSF7 protein (Cat# TP312844). The protein was produced from HEK293T cells transfected with RASSF7 cDNA clone (Cat# RC212844) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212844
• Predicted MW: 39.8 kDa
• Protein Sequence:
  Sequence Link

  >RC212844 representing NM_003475
  Red=Cloning site Green=Tags(s)
  
  MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQ
  ATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPG
  PAAPVTPTPGCCTDLRGLELRVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL
  DAQARALEAELQLAAEAPGPPSPMASATERLHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQEL
  EELNRELRQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDA
  ELLEVAAAPAPEWCPLAAQPQAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003466
• RefSeq Size: 1539
• RefSeq ORF: 1119
• Synonyms: C11orf13; CFAP88; FAP88; HRAS1; HRC1
• Locus ID: 8045
• UniProt ID: Q02833, A0A024RCE4
• Cytogenetics: 11p15.5
• Summary: Negatively regulates stress-induced JNK activation and apoptosis by promoting MAP2K7 phosphorylation and inhibiting its ability to activate JNK. Following prolonged stress, anti-apoptotic effect stops because of degradation of RASSF7 protein via the ubiquitin-proteasome pathway. Required for the activation of AURKB and chromosomal congression during mitosis where it stimulates microtubule polymerization.[UniProtKB/Swiss-Prot Function]