OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MTH1 (NUDT1) (NM_198953) Human Mass Spec Standard

Be the first to review this product
SKU
PH312808
NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945191)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA379394 MTH1 Rabbit polyclonal Antibody
100 ul
$475.00
LY419314 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MTH1 or NM_198953"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212808
Predicted MW 17.8 kDa
Protein Sequence
Protein Sequence
>RC212808 representing NM_198953
Red=Cloning site Green=Tags(s)

MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQI
VFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQ
GQDTILDYTLREVDTV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_945191
RefSeq Size 728
RefSeq ORF 468
Synonyms MTH1
Locus ID 4521
UniProt ID P36639
Cytogenetics 7p22.3
Summary Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A rare single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. provided by RefSeq, Dec 2018
Protein Families Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MTH1" proteins (23)
SKU Description Size Price
PH301148 NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945190) 10 ug
$3,360.00
PH308551 NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_002443) 10 ug
$3,360.00
PH312655 NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945186) 10 ug
$3,360.00
PH312705 NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945187) 10 ug
$3,360.00
PH312761 NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945188) 10 ug
$3,360.00
LC404632 Lyophilized NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404633 Lyophilized NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404634 Lyophilized NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404636 Lyophilized NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404637 Lyophilized NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419314 Lyophilized NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404632 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2A (as WB positive control) 100 ug
$436.00
LY404633 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2B (as WB positive control) 100 ug
$436.00
LY404634 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3A (as WB positive control) 100 ug
$436.00
LY404636 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4A (as WB positive control) 100 ug
$436.00
LY404637 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4B (as WB positive control) 100 ug
$436.00
LY419314 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301148 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3B, 20 µg 20 ug
$867.00
TP308551 Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1, 20 µg 20 ug
$867.00
TP312655 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2A, 20 µg 20 ug
$867.00
TP312705 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2B, 20 µg 20 ug
$867.00
TP312761 Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3A, 20 µg 20 ug
$867.00
TP312808 Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4A, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products