OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NPHS2 (NM_014625) Human Mass Spec Standard

Be the first to review this product
SKU
PH312676
NPHS2 MS Standard C13 and N15-labeled recombinant protein (NP_055440)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415156 Transient overexpression lysate of nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2) (as WB positive control) 100 ug
$436.00

Other products for "NPHS2 or NM_014625"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212676
Predicted MW 42 kDa
Protein Sequence
Protein Sequence
>RC212676 representing NM_014625
Red=Cloning site Green=Tags(s)

MERRARSSSRESRGRGGRTPHKENKRAKAERSGGGRGRQEAGPEPSGSGRAGTPGEPRAPAATVVDVDEV
RGSGEEGTEVVALLESERPEEGTKSSGLGACEWLLVLISLLFIIMTFPFSIWFCVKVVQEYERVIIFRLG
HLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASLLLSSLAHV
SKAVQFLVQTTMKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAV
EAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCL
SSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055440
RefSeq Size 1853
RefSeq ORF 1149
Synonyms PDCN; SRN1
Locus ID 7827
UniProt ID Q9NP85
Cytogenetics 1q25.2
Summary This gene encodes a protein that plays a role in the regulation of glomerular permeability. Mutations in this gene cause steroid-resistant nephrotic syndrome. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2014
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NPHS2" proteins (3)
SKU Description Size Price
LC415156 Lyophilized NPHS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415156 Transient overexpression lysate of nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2) (as WB positive control) 100 ug
$436.00
TP312676 Recombinant protein of human nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products