OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MSK2 / RSK-B (RPS6KA4) (NM_003942) Human Mass Spec Standard

Be the first to review this product
SKU
PH312570
RPS6KA4 MS Standard C13 and N15-labeled recombinant protein (NP_003933)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA381127 RPS6KA4 Rabbit polyclonal Antibody
100 ul
$410.00
LY423559 Transient overexpression lysate of ribosomal protein S6 kinase, 90kDa, polypeptide 4 (RPS6KA4), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "MSK2 / RSK-B or NM_003942"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212570
Predicted MW 85.4 kDa
Protein Sequence
Protein Sequence
>RC212570 representing NM_003942
Red=Cloning site Green=Tags(s)

MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGKLYAMKVLRKA
ALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSGGEMFTHLYQRQYFKEAEVRV
YGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDFGLSKEFLTEEKERTFSFCGTIEYMAPEIIR
SKTGHGKAVDWWSLGILLFELLTGASPFTLEGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKD
PKKRLGAGPQGAQEVRNHPFFQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPP
GDPRIFQGYSFVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTYLVLELLRGGE
LLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYADDTPGAPVKIIDFGFARLRPQ
SPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILYMMLSGQVPFQGASGQGGQSQAAEIMCKIRE
GRFSLDGEAWQGVSEEAKELVRGLLTVDPAKRLKLEGLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRS
GLNATFMAFNRGKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLP
PS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003933
RefSeq Size 3149
RefSeq ORF 2316
Synonyms MSK2; RSK-B; S6K-alpha-4
Locus ID 8986
UniProt ID O75676
Cytogenetics 11q13.1
Summary This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and ATF1. The encoded protein can also phosphorylate histone H3 to regulate certain inflammatory genes. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jan 2016
Protein Families Druggable Genome, Protein Kinase, Transcription Factors
Protein Pathways MAPK signaling pathway, Neurotrophin signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MSK2 / RSK-B" proteins (5)
SKU Description Size Price
LC418335 Lyophilized RPS6KA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423559 Lyophilized RPS6KA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418335 Transient overexpression lysate of ribosomal protein S6 kinase, 90kDa, polypeptide 4 (RPS6KA4), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY423559 Transient overexpression lysate of ribosomal protein S6 kinase, 90kDa, polypeptide 4 (RPS6KA4), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP312570 Recombinant protein of human ribosomal protein S6 kinase, 90kDa, polypeptide 4 (RPS6KA4), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products