OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD83 (NM_001040280) Human Mass Spec Standard

Be the first to review this product
SKU
PH312520
CD83 MS Standard C13 and N15-labeled recombinant protein (NP_001035370)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369928 CD83 rabbit polyclonal antibody
100 ul
$310.00
LY421736 Transient overexpression lysate of CD83 molecule (CD83), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CD83 or NM_001040280"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212520
Predicted MW 23 kDa
Protein Sequence
Protein Sequence
>RC212520 protein sequence
Red=Cloning site Green=Tags(s)

MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRG
QHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKK
YRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035370
RefSeq Size 2475
RefSeq ORF 615
Synonyms BL11; HB15
Locus ID 9308
UniProt ID Q01151
Cytogenetics 6p23
Summary The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2011
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD83" proteins (8)
SKU Description Size Price
PH305302 CD83 MS Standard C13 and N15-labeled recombinant protein (NP_004224) 10 ug
$3,360.00
LC401360 Lyophilized CD83 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421736 Lyophilized CD83 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401360 Transient overexpression lysate of CD83 molecule (CD83), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421736 Transient overexpression lysate of CD83 molecule (CD83), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305302 Recombinant protein of human CD83 molecule (CD83), transcript variant 1, 20 µg 20 ug
$737.00
TP312520 Recombinant protein of human CD83 molecule (CD83), transcript variant 2, 20 µg 20 ug
$737.00
TP720345 Recombinant protein of human CD83 molecule (CD83), transcript variant 2 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products