OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PKIB (NM_181795) Human Mass Spec Standard

Be the first to review this product
SKU
PH312372
PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861460)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA314384 Rabbit polyclonal anti-IPKB antibody
100 ul
$380.00
LY405587 Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PKIB or NM_181795"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212372
Predicted MW 8.3 kDa
Protein Sequence
Protein Sequence
>RC212372 representing NM_181795
Red=Cloning site Green=Tags(s)

MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL
EKPQNEEK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_861460
RefSeq Size 1909
RefSeq ORF 234
Synonyms PRKACN2
Locus ID 5570
UniProt ID Q9C010
Cytogenetics 6q22.31
Summary This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role in prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Jul 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PKIB" proteins (11)
SKU Description Size Price
PH316291 PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861459) 10 ug
$3,360.00
LC405587 Lyophilized PKIB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405588 Lyophilized PKIB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410103 Lyophilized PKIB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405587 Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY405588 Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY410103 Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP312372 Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1, 20 µg 20 ug
$867.00
TP316291 Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2, 20 µg 20 ug
$867.00
TP720220 Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3 10 ug
$340.00
TP761370 Purified recombinant protein of Human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products