OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TAS1R1 (NM_177540) Human Mass Spec Standard

Be the first to review this product
SKU
PH312370
TAS1R1 MS Standard C13 and N15-labeled recombinant protein (NP_803884)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA317408 T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
50 ug
$550.00
LY403591 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 3 (as WB positive control) 100 ug
$665.00

Other products for "TAS1R1 or NM_177540"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212370
Predicted MW 65 kDa
Protein Sequence
Protein Sequence
>RC212370 representing NM_177540
Red=Cloning site Green=Tags(s)

MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVTLCDRSCSFNE
HGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLSLPGQHHIELQGDLLHYSPTV
LAVIGPDSTNRAATTAALLSPFLVPMLLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFT
VLGSSTWSPVQLNINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLY
RCQPCGKEEWAPEGSQTCFPRTVVFLALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSAGGRL
CFLMLGSLAAGSGSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIFKFSTKVPTFYHAWV
QNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLECTETNSLGFILAFLYNGLLSISAFA
CSYLGKDLPENYNEAKCVTFSLLFNFVSWIAFFTTASVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYV
ILCRPDLNSTEHFQASIQDYTRRCGST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_803884
RefSeq Size 1945
RefSeq ORF 1761
Synonyms GM148; GPR70; T1R1; TR1
Locus ID 80835
UniProt ID Q7RTX1
Cytogenetics 1p36.31
Summary The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jun 2010
Protein Families Druggable Genome, Transmembrane
Protein Pathways Taste transduction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TAS1R1" proteins (7)
SKU Description Size Price
LC403591 Lyophilized TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406077 Lyophilized TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408549 Lyophilized TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403591 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY406077 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY408549 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP312370 Recombinant protein of human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products