TAS1R1 (NM_177540) Human Recombinant Protein

SKU
TP312370
Recombinant protein of human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212370 representing NM_177540
Red=Cloning site Green=Tags(s)

MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVTLCDRSCSFNE
HGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLSLPGQHHIELQGDLLHYSPTV
LAVIGPDSTNRAATTAALLSPFLVPMLLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFT
VLGSSTWSPVQLNINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLY
RCQPCGKEEWAPEGSQTCFPRTVVFLALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSAGGRL
CFLMLGSLAAGSGSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIFKFSTKVPTFYHAWV
QNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLECTETNSLGFILAFLYNGLLSISAFA
CSYLGKDLPENYNEAKCVTFSLLFNFVSWIAFFTTASVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYV
ILCRPDLNSTEHFQASIQDYTRRCGST

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 65 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_803884
Locus ID 80835
UniProt ID Q7RTX1
Cytogenetics 1p36.31
RefSeq Size 1945
RefSeq ORF 1761
Synonyms GM148; GPR70; T1R1; TR1
Summary The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Taste transduction
Write Your Own Review
You're reviewing:TAS1R1 (NM_177540) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312370 TAS1R1 MS Standard C13 and N15-labeled recombinant protein (NP_803884) 10 ug
$3,255.00
LC403591 TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406077 TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408549 TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403591 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 3 100 ug
$665.00
LY406077 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 4 100 ug
$436.00
LY408549 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 2 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.