TAS1R1 (NM_177540) Human Mass Spec Standard

SKU
PH312370
TAS1R1 MS Standard C13 and N15-labeled recombinant protein (NP_803884)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212370]
Predicted MW 65 kDa
Protein Sequence
Protein Sequence
>RC212370 representing NM_177540
Red=Cloning site Green=Tags(s)

MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVTLCDRSCSFNE
HGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLSLPGQHHIELQGDLLHYSPTV
LAVIGPDSTNRAATTAALLSPFLVPMLLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFT
VLGSSTWSPVQLNINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLY
RCQPCGKEEWAPEGSQTCFPRTVVFLALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSAGGRL
CFLMLGSLAAGSGSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIFKFSTKVPTFYHAWV
QNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLECTETNSLGFILAFLYNGLLSISAFA
CSYLGKDLPENYNEAKCVTFSLLFNFVSWIAFFTTASVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYV
ILCRPDLNSTEHFQASIQDYTRRCGST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_803884
RefSeq Size 1945
RefSeq ORF 1761
Synonyms GM148; GPR70; T1R1; TR1
Locus ID 80835
UniProt ID Q7RTX1
Cytogenetics 1p36.31
Summary The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Taste transduction
Write Your Own Review
You're reviewing:TAS1R1 (NM_177540) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403591 TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406077 TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408549 TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403591 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 3 100 ug
$665.00
LY406077 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 4 100 ug
$436.00
LY408549 Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 2 100 ug
$665.00
TP312370 Recombinant protein of human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.