OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPRYD3 (NM_032840) Human Mass Spec Standard

Be the first to review this product
SKU
PH312360
SPRYD3 MS Standard C13 and N15-labeled recombinant protein (NP_116229)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA320061 Rabbit Polyclonal SPRYD3 Antibody
100 ug
$640.00
LY409823 Transient overexpression lysate of SPRY domain containing 3 (SPRYD3) (as WB positive control) 100 ug
$665.00

Other products for "SPRYD3 or NM_032840"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212360
Predicted MW 49.5 kDa
Protein Sequence
Protein Sequence
>RC212360 representing NM_032840
Red=Cloning site Green=Tags(s)

MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHGNSGEVGCYVA
SRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCN
SGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPDGLFPAVGMHSLGEEVRLHLNAELGREDDSV
MMVDSYEDEWGRLHDVRVCGTLLEYLGKGKSIVDVGLAQARHPLSTRSHYFEVEIVDPGEKCYIALGLAR
KDYPKNRHPGWSRGSVAYHADDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTV
ILSPTARAVRNVRNVMYLHQEGEEEEEEEEEEEDGEEIEPEHEGRKVVVFFTRNGKIIGKKDAVVPSGGF
FPTIGMLSCGEKVKVDLHPLSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116229
RefSeq Size 2568
RefSeq ORF 1326
Locus ID 84926
UniProt ID Q8NCJ5
Cytogenetics 12q13.13
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPRYD3" proteins (3)
SKU Description Size Price
LC409823 Lyophilized SPRYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409823 Transient overexpression lysate of SPRY domain containing 3 (SPRYD3) (as WB positive control) 100 ug
$665.00
TP312360 Recombinant protein of human SPRY domain containing 3 (SPRYD3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products