OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

XYLB (NM_005108) Human Mass Spec Standard

Be the first to review this product
SKU
PH312021
XYLB MS Standard C13 and N15-labeled recombinant protein (NP_005099)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308165 Rabbit polyclonal antibody to XYLB (xylulokinase homolog (H. influenzae))
100 ul
$665.00
LY417522 Transient overexpression lysate of xylulokinase homolog (H. influenzae) (XYLB) (as WB positive control) 100 ug
$665.00

Other products for "XYLB or NM_005108"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212021
Predicted MW 58.2 kDa
Protein Sequence
Protein Sequence
>RC212021 representing NM_005108
Red=Cloning site Green=Tags(s)

MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQ
ALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDS
STTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSP
IDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGD
NPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNES
VSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKR
IHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFS
EVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005099
RefSeq Size 3694
RefSeq ORF 1608
Locus ID 9942
UniProt ID O75191
Cytogenetics 3p22.2
Summary The protein encoded by this gene shares 22% sequence identity with Hemophilus influenzae xylulokinase, and even higher identity to other gene products in C.elegans (45%) and yeast (31-35%), which are thought to belong to a family of enzymes that include fucokinase, gluconokinase, glycerokinase and xylulokinase. These proteins play important roles in energy metabolism. provided by RefSeq, Aug 2009
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pentose and glucuronate interconversions
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "XYLB" proteins (3)
SKU Description Size Price
LC417522 Lyophilized XYLB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417522 Transient overexpression lysate of xylulokinase homolog (H. influenzae) (XYLB) (as WB positive control) 100 ug
$665.00
TP312021 Recombinant protein of human xylulokinase homolog (H. influenzae) (XYLB), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products