SIT (SIT1) (NM_014450) Human Mass Spec Standard

CAT#: PH311968

SIT1 MS Standard C13 and N15-labeled recombinant protein (NP_055265)

Product Images

Coomassie blue staining of purified SIT1 protein (Cat# TP311968). The protein was produced from HEK293T cells transfected with SIT1 cDNA clone (Cat# RC211968) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211968
• Predicted MW: 21.1 kDa
• Protein Sequence:
  Sequence Link

  >RC211968 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNQADPRLRAVCLWTLTSAAMSRGDNCTDLLALGIPSITQAWGLWVLLGAVTLLFLISLAAHLSQWTRGR
  SRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIP
  GPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055265
• RefSeq Size: 1238
• RefSeq ORF: 588
• Synonyms: SIT; SIT-R
• Locus ID: 27240
• UniProt ID: Q9Y3P8
• Cytogenetics: 9p13.3
• Summary: Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells. Involved in positive selection of T-cells.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane