OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC43 (NM_144609) Human Mass Spec Standard

Be the first to review this product
SKU
PH311896
CCDC43 MS Standard C13 and N15-labeled recombinant protein (NP_653210)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA356992 CCDC43 Antibody - N-terminal region
100 ul
$585.00
LY408244 Transient overexpression lysate of coiled-coil domain containing 43 (CCDC43), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CCDC43 or NM_144609"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211896
Predicted MW 25.1 kDa
Protein Sequence
Protein Sequence
>RC211896 representing NM_144609
Red=Cloning site Green=Tags(s)

MAAPSEVAAIAPGEGDGGGGGFGSWLDGRLEALGVDRAVYGAYILGILQEEEEEEKLDALQGILSAFLEE
DSLLNICKEIVERWSETQNVVTKVKKEDEVQAIATLIEKQAQIVVKPRMVSEEEKQRKAALLAQYADVTD
EEDEADEKDDSGATTMNIGSDKLLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERK
EKEKKRTQRGERKR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653210
RefSeq Size 2082
RefSeq ORF 672
Locus ID 124808
UniProt ID Q96MW1
Cytogenetics 17q21.31
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC43" proteins (7)
SKU Description Size Price
PH311843 CCDC43 MS Standard C13 and N15-labeled recombinant protein (NP_001092695) 10 ug
$3,360.00
LC408244 Lyophilized CCDC43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420375 Lyophilized CCDC43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408244 Transient overexpression lysate of coiled-coil domain containing 43 (CCDC43), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420375 Transient overexpression lysate of coiled-coil domain containing 43 (CCDC43), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP311843 Recombinant protein of human coiled-coil domain containing 43 (CCDC43), transcript variant 2, 20 µg 20 ug
$867.00
TP311896 Recombinant protein of human coiled-coil domain containing 43 (CCDC43), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products