CCDC43 (NM_001099225) Human Mass Spec Standard

SKU
PH311843
CCDC43 MS Standard C13 and N15-labeled recombinant protein (NP_001092695)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211843]
Predicted MW 16.6 kDa
Protein Sequence
Protein Sequence
>RC211843 representing NM_001099225
Red=Cloning site Green=Tags(s)

MAAPSEVAAIAPGEGDGGGGGFGSWLDGRLEALGVDRAVYGAYILGILQEEEEEEKLDALQGILSAFLEE
DSLLNICKEIVERWSETQNVVTKVKKEDEVQAIATLIEKQAQIVVKPRMVSEEEKQRKAALLAQYADVTD
EEDSVPKHQCGRCP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092695
RefSeq Size 2088
RefSeq ORF 462
Locus ID 124808
UniProt ID Q96MW1
Cytogenetics 17q21.31
Write Your Own Review
You're reviewing:CCDC43 (NM_001099225) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH311896 CCDC43 MS Standard C13 and N15-labeled recombinant protein (NP_653210) 10 ug
$3,255.00
LC408244 CCDC43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420375 CCDC43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408244 Transient overexpression lysate of coiled-coil domain containing 43 (CCDC43), transcript variant 1 100 ug
$436.00
LY420375 Transient overexpression lysate of coiled-coil domain containing 43 (CCDC43), transcript variant 2 100 ug
$436.00
TP311843 Recombinant protein of human coiled-coil domain containing 43 (CCDC43), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311896 Recombinant protein of human coiled-coil domain containing 43 (CCDC43), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.