OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MARCHF8 (NM_001002265) Human Mass Spec Standard

Be the first to review this product
SKU
PH311771
MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002265)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306677 Rabbit Polyclonal MARCH8 Antibody
100 ug
$640.00
LY408083 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8 (as WB positive control) 100 ug
$436.00

Other products for "MARCH8 or NM_001002265"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211771
Predicted MW 32.8 kDa
Protein Sequence
Protein Sequence
>RC211771 representing NM_001002265
Red=Cloning site Green=Tags(s)

MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRT
SITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR
KWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTG
GLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTE
PEDTGAEIIHV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001002265
RefSeq Size 2604
RefSeq ORF 873
Synonyms c-MIR; MARCH-VIII; MIR; RNF178
Locus ID 220972
UniProt ID Q5T0T0
Cytogenetics 10q11.21-q11.22
Summary MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 PubMed 12582153; Bartee et al., 2004 PubMed 14722266).supplied by OMIM, Apr 2010
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MARCH8" proteins (11)
SKU Description Size Price
PH305477 MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002266) 10 ug
$3,360.00
PH309891 MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_659458) 10 ug
$3,360.00
LC408083 Lyophilized 42071 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424197 Lyophilized 42071 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424198 Lyophilized 42071 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408083 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8 (as WB positive control) 100 ug
$436.00
LY424197 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY424198 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7 (as WB positive control) 100 ug
$436.00
TP305477 Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7, 20 µg 20 ug
$867.00
TP309891 Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8, 20 µg 20 ug
$867.00
TP311771 Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products