MARCHF8 (NM_145021) Human Recombinant Protein

SKU
TP309891
Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209891 protein sequence
Red=Cloning site Green=Tags(s)

MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRT
SITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR
KWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTG
GLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTE
PEDTGAEIIHV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_659458
Locus ID 220972
UniProt ID Q5T0T0
Cytogenetics 10q11.21-q11.22
RefSeq Size 5300
RefSeq ORF 873
Synonyms c-MIR; CMIR; MARCH-VIII; MARCH8; MIR; RNF178
Summary MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Apr 2010]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:MARCHF8 (NM_145021) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305477 MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002266) 10 ug
$3,255.00
PH309891 MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_659458) 10 ug
$3,255.00
PH311771 MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002265) 10 ug
$3,255.00
LC408083 42071 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424197 42071 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424198 42071 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408083 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8 100 ug
$436.00
LY424197 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6 100 ug
$436.00
LY424198 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7 100 ug
$436.00
TP305477 Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311771 Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.