OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL36RN (NM_012275) Human Mass Spec Standard

Be the first to review this product
SKU
PH311691
IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_036407)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326668 Rabbit Polyclonal IL-36RN Antibody
100 ug
$640.00
LY402185 Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "IL36RN or NM_012275"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211691
Predicted MW 16.8 kDa
Protein Sequence
Protein Sequence
>RC211691 representing NM_012275
Red=Cloning site Green=Tags(s)

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC
GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG
GWNAPITDFYFQQCD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036407
RefSeq Size 2717
RefSeq ORF 465
Synonyms FIL1; FIL1(DELTA); FIL1D; IL-36Ra; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; PSORP; PSORS14
Locus ID 26525
UniProt ID Q9UBH0
Cytogenetics 2q14.1
Summary The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IL36RN" proteins (7)
SKU Description Size Price
PH305747 IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_775262) 10 ug
$3,360.00
LC402185 Lyophilized IL36RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406658 Lyophilized IL36RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402185 Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY406658 Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305747 Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 20 µg 20 ug
$867.00
TP311691 Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products