OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COP (CARD16) (NM_052889) Human Mass Spec Standard

Be the first to review this product
SKU
PH311537
CARD16 MS Standard C13 and N15-labeled recombinant protein (NP_443121)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA372264 CARD16 rabbit polyclonal antibody
100 ul
$310.00
LY409399 Transient overexpression lysate of caspase recruitment domain family, member 16 (CARD16), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "COP or NM_052889"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211537
Predicted MW 10.6 kDa
Protein Sequence
Protein Sequence
>RC211537 representing NM_052889
Red=Cloning site Green=Tags(s)

MRKAMADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGA
QACQICITYICEEDSYLAETLGLSAGPIPGN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443121
RefSeq Size 758
RefSeq ORF 303
Synonyms COP; COP1; PSEUDO-ICE
Locus ID 114769
UniProt ID Q5EG05
Cytogenetics 11q22.3
Summary Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. Also induces NF-kappa-B activation during the pro-inflammatory cytokine response. Also able to inhibit CASP1-mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, and staurosporine-mediated cell death but not ER stress-mediated cell death. Acts by preventing activation of caspases CASP1 and CASP4, possibly by preventing the interaction between CASP1 and RIPK2.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COP" proteins (6)
SKU Description Size Price
LC409399 Lyophilized CARD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422744 Lyophilized CARD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409399 Transient overexpression lysate of caspase recruitment domain family, member 16 (CARD16), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422744 Transient overexpression lysate of caspase recruitment domain family, member 16 (CARD16), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP311537 Recombinant protein of human caspase recruitment domain family, member 16 (CARD16), transcript variant 2, 20 µg 20 ug
$867.00
TP760353 Purified recombinant protein of Human caspase recruitment domain family, member 16 (CARD16), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products