OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OSBPL9 (NM_148909) Human Mass Spec Standard

Be the first to review this product
SKU
PH311520
OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683707)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA356567 OSBPL9 Antibody - N-terminal region
100 ul
$585.00
LY407760 Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "OSBPL9 or NM_148909"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211520
Predicted MW 84.1 kDa
Protein Sequence
Protein Sequence
>RC211520 representing NM_148909
Red=Cloning site Green=Tags(s)

MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKMMRGSRRGCVRLRGAVIGIDDEDDSTFTI
TVDQKTFHFQARDADEREKWIHALEETILRHTLQLQISTTLAFFQSSGISPVLEFSKIIGLDSGFVPSVQ
DFDKKLTEADAYLQILIEQLKLFDDKLQNCKEDEQRKKIETLKETTNSMVESIKHCIVLLQIAKSTINPV
DAIYQPSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSL
TSPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLN
SSLSNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMHLLSQVRLGMDLTKVVLPTFILERRSLLEMYADF
FAHPDLFVSISDQKDPKDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVS
EGPVPWVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLDYD
EHYILTFPNGYGRSILTVPWVELGGECNINCSKTGYSANIIFHTKPFYGGKKHRITAEIFSPNDKKSFCS
IEGEWNGVMYAKYATGENTVFVDTKKLPIIKKKVRKLEDQNEYESRSLWKDVTFNLKIRDIDAATEAKHR
LEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_683707
RefSeq Size 2949
RefSeq ORF 2238
Synonyms ORP-9; ORP9
Locus ID 114883
UniProt ID Q96SU4
Cytogenetics 1p32.3
Summary This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. This family member functions as a cholesterol transfer protein that regulates Golgi structure and function. Multiple transcript variants, most of which encode distinct isoforms, have been identified. Related pseudogenes have been identified on chromosomes 3, 11 and 12. provided by RefSeq, Jul 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OSBPL9" proteins (19)
SKU Description Size Price
PH321053 OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683706) 10 ug
$3,360.00
PH321526 OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683705) 10 ug
$3,360.00
LC407760 Lyophilized OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407761 Lyophilized OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407762 Lyophilized OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407763 Lyophilized OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407764 Lyophilized OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407765 Lyophilized OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407760 Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY407761 Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY407762 Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY407763 Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY407764 Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 5 (as WB positive control) 100 ug
$665.00
LY407765 Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 7 (as WB positive control) 100 ug
$665.00
TP311520 Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 7, 20 µg 20 ug
$737.00
TP321053 Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 5, 20 µg 20 ug
$737.00
TP321526 Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 4, 20 µg 20 ug
$737.00
TP760439 Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00
TP760538 Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products