OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KRT24 (NM_019016) Human Mass Spec Standard

Be the first to review this product
SKU
PH311286
KRT24 MS Standard C13 and N15-labeled recombinant protein (NP_061889)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803131 KRT24 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8) 100 ul
$447.00
LY412810 Transient overexpression lysate of keratin 24 (KRT24) (as WB positive control) 100 ug
$436.00

Other products for "KRT24 or NM_019016"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211286
Predicted MW 55.1 kDa
Protein Sequence
Protein Sequence
>RC211286 protein sequence
Red=Cloning site Green=Tags(s)

MSCSSRASSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAFGGSFGGGFGS
CSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGATGGFYSYGGGMGGGVGDGGLFSGGE
KQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYGPGSGDGGSGRDYSKYYSIIEDLRNQIIAAT
VENAGIILHIDNARLAADDFRLKYENELCLRQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLR
KNHEEEMKNMQGSSGGEVTVEMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEERFNKQSASLQAQISTD
AGAATSAKNEITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIWGE
TKCQNAEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRDLVSGDSRSGSCSGQG
RDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061889
RefSeq Size 1897
RefSeq ORF 1575
Synonyms K24; KA24
Locus ID 192666
UniProt ID Q2M2I5
Cytogenetics 17q21.2
Summary This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. provided by RefSeq, Jun 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KRT24" proteins (3)
SKU Description Size Price
LC412810 Lyophilized KRT24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412810 Transient overexpression lysate of keratin 24 (KRT24) (as WB positive control) 100 ug
$436.00
TP311286 Recombinant protein of human keratin 24 (KRT24), 20 µg 20 ug
$1,290.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products