OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OTOS (NM_148961) Human Mass Spec Standard

Be the first to review this product
SKU
PH311259
OTOS MS Standard C13 and N15-labeled recombinant protein (NP_683764)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA338813 Rabbit Polyclonal Anti-OTOS Antibody
100 ul
$585.00
LY407724 Transient overexpression lysate of otospiralin (OTOS) (as WB positive control) 100 ug
$436.00

Other products for "OTOS or NM_148961"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211259
Predicted MW 9.9 kDa
Protein Sequence
Protein Sequence
>RC211259 protein sequence
Red=Cloning site Green=Tags(s)

MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTF
FAHFPLGSTLGFHVPYQED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_683764
RefSeq Size 566
RefSeq ORF 267
Synonyms OTOSP
Locus ID 150677
UniProt ID Q8NHW6
Cytogenetics 2q37.3
Summary Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness (Lavigne-Rebillard et al., 2003 PubMed 12687421).supplied by OMIM, Mar 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OTOS" proteins (3)
SKU Description Size Price
LC407724 Lyophilized OTOS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407724 Transient overexpression lysate of otospiralin (OTOS) (as WB positive control) 100 ug
$436.00
TP311259 Recombinant protein of human otospiralin (OTOS), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products