OriGene Logo

OTOS Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338813
Rabbit Polyclonal Anti-OTOS Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407724 Transient overexpression lysate of otospiralin (OTOS) 100 ug
$436.00
TP311259 Recombinant protein of human otospiralin (OTOS), 20 µg
20 ug
$867.00

View other "OTOS or NM_148961" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-OTOS antibody: synthetic peptide directed towards the N terminal of human OTOS. Synthetic peptide located within the following region: MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 10 kDa
Gene Name otospiralin
Database Link
Background OTOS may be essential for the survival of the neurosensory epithelium of the inner ear.
Synonyms OTOSP
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Pig: 79%
Reference Data
Protein Categories Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.