OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

REXO2 (NM_015523) Human Mass Spec Standard

Be the first to review this product
SKU
PH311236
REXO2 MS Standard C13 and N15-labeled recombinant protein (NP_056338)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380860 REXO2 Rabbit polyclonal Antibody
100 ul
$410.00
LY414494 Transient overexpression lysate of REX2, RNA exonuclease 2 homolog (S. cerevisiae) (REXO2) (as WB positive control) 100 ug
$436.00

Other products for "REXO2 or NM_015523"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211236
Predicted MW 26.8 kDa
Protein Sequence
Protein Sequence
>RC211236 protein sequence
Red=Cloning site Green=Tags(s)

MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDS
DLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLA
GNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFY
RNNIFKKKIDEKKRKIIENGENEKTVS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056338
RefSeq Size 1171
RefSeq ORF 711
Synonyms CGI-114; REX2; RFN; SFN
Locus ID 25996
UniProt ID Q9Y3B8
Cytogenetics 11q23.2
Summary This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradation. It may also be involved in resistance of human cells to UV-C-induced cell death through its role in the DNA repair process. provided by RefSeq, Nov 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "REXO2" proteins (3)
SKU Description Size Price
LC414494 Lyophilized REXO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414494 Transient overexpression lysate of REX2, RNA exonuclease 2 homolog (S. cerevisiae) (REXO2) (as WB positive control) 100 ug
$436.00
TP311236 Recombinant protein of human REX2, RNA exonuclease 2 homolog (S. cerevisiae) (REXO2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products