OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BCL2L2 (NM_004050) Human Mass Spec Standard

Be the first to review this product
SKU
PH311152
BCL2L2 MS Standard C13 and N15-labeled recombinant protein (NP_004041)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA302168 Bcl-w Antibody (BH3 Domain Specific)
400 ul
$645.00
LY401312 Transient overexpression lysate of BCL2-like 2 (BCL2L2) (as WB positive control) 100 ug
$436.00

Other products for "BCL2L2 or NM_004050"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211152
Predicted MW 20.8 kDa
Protein Sequence
Protein Sequence
>RC211152 protein sequence
Red=Cloning site Green=Tags(s)

MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV
TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHS
SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004041
RefSeq Size 3621
RefSeq ORF 579
Synonyms BCL-W; BCL2-L-2; BCLW; PPP1R51
Locus ID 599
UniProt ID Q92843
Cytogenetics 14q11.2
Summary This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. provided by RefSeq, Dec 2010
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BCL2L2" proteins (4)
SKU Description Size Price
LC401312 Lyophilized BCL2L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401312 Transient overexpression lysate of BCL2-like 2 (BCL2L2) (as WB positive control) 100 ug
$436.00
TP311152 Recombinant protein of human BCL2-like 2 (BCL2L2), 20 µg 20 ug
$737.00
TP720086 Recombinant protein of human BCL2-like 2 (BCL2L2) 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products