OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FAHD2A (NM_016044) Human Mass Spec Standard

Be the first to review this product
SKU
PH311128
FAHD2A MS Standard C13 and N15-labeled recombinant protein (NP_057128)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500939 Anti-FAHD2A mouse monoclonal antibody, clone OTI6D9 (formerly 6D9) 100 ul
$447.00
LY402492 Transient overexpression lysate of fumarylacetoacetate hydrolase domain containing 2A (FAHD2A) (as WB positive control) 100 ug
$436.00

Other products for "FAHD2A or NM_016044"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211128
Predicted MW 34.6 kDa
Protein Sequence
Protein Sequence
>RC211128 protein sequence
Red=Cloning site Green=Tags(s)

MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFL
EQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSI
VGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKT
FDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTP
PGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057128
RefSeq Size 1313
RefSeq ORF 942
Synonyms CGI-105
Locus ID 51011
UniProt ID Q96GK7
Cytogenetics 2q11.1
Summary May have hydrolase activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FAHD2A" proteins (3)
SKU Description Size Price
LC402492 Lyophilized FAHD2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402492 Transient overexpression lysate of fumarylacetoacetate hydrolase domain containing 2A (FAHD2A) (as WB positive control) 100 ug
$436.00
TP311128 Recombinant protein of human fumarylacetoacetate hydrolase domain containing 2A (FAHD2A), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products