OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SUMF1 (NM_182760) Human Mass Spec Standard

Be the first to review this product
SKU
PH311092
SUMF1 MS Standard C13 and N15-labeled recombinant protein (NP_877437)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800632 SUMF1 mouse monoclonal antibody,clone OTI1B10 100 ul
$447.00
LY431311 Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "SUMF1 or NM_182760"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211092
Predicted MW 40.6 kDa
Protein Sequence
Protein Sequence
>RC211092 protein sequence
Red=Cloning site Green=Tags(s)

MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRY
SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFV
NSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVS
WNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAP
VDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS
QNTPDSSASNLGFRCAADRLPTMD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_877437
RefSeq Size 2179
RefSeq ORF 1122
Synonyms AAPA3037; FGE; UNQ3037
Locus ID 285362
UniProt ID Q8NBK3
Cytogenetics 3p26.1
Summary This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. provided by RefSeq, Sep 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SUMF1" proteins (8)
SKU Description Size Price
LC405331 Lyophilized SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431307 Lyophilized SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431311 Lyophilized SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405331 Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431307 Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431311 Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP311092 Recombinant protein of human sulfatase modifying factor 1 (SUMF1), 20 µg 20 ug
$867.00
TP720417 Recombinant protein of human sulfatase modifying factor 1 (SUMF1) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products