OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBL5 (NM_001048241) Human Mass Spec Standard

Be the first to review this product
SKU
PH311076
UBL5 MS Standard C13 and N15-labeled recombinant protein (NP_001041706)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA389631 UBL5 Rabbit pAb
100 ul
$410.00
LY402981 Transient overexpression lysate of ubiquitin-like 5 (UBL5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "UBL5 or NM_001048241"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211076
Predicted MW 8.5 kDa
Protein Sequence
Protein Sequence
>RC211076 protein sequence
Red=Cloning site Green=Tags(s)

MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLEL
YYQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001041706
RefSeq Size 469
RefSeq ORF 219
Synonyms HUB1
Locus ID 59286
UniProt ID Q9BZL1
Cytogenetics 19p13.2
Summary This gene encodes a member of a group of proteins similar to ubiquitin. The encoded protein is not thought to degrade proteins like ubiquitin but to affect their function through being bound to target proteins by an isopeptide bond. The gene product has been studied as a link to predisposition to obesity based on its expression in Psammomys obesus, the fat sand rat, which is an animal model for obesity studies. Variation in this gene was found to be significantly associated with some metabolic traits (PMID: 15331561) but not associated with childhood obesity (PMID: 19189687). Pseudogenes of this gene are located on chromosomes 3, 5 and 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. provided by RefSeq, Jan 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBL5" proteins (7)
SKU Description Size Price
PH302790 UBL5 MS Standard C13 and N15-labeled recombinant protein (NP_077268) 10 ug
$3,360.00
LC402981 Lyophilized UBL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420793 Lyophilized UBL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402981 Transient overexpression lysate of ubiquitin-like 5 (UBL5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420793 Transient overexpression lysate of ubiquitin-like 5 (UBL5), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302790 Recombinant protein of human ubiquitin-like 5 (UBL5), transcript variant 1, 20 µg 20 ug
$867.00
TP311076 Recombinant protein of human ubiquitin-like 5 (UBL5), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products