OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SERPINB13 (NM_012397) Human Mass Spec Standard

Be the first to review this product
SKU
PH311032
SERPINB13 MS Standard C13 and N15-labeled recombinant protein (NP_036529)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503672 SERPINB13 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6) 100 ul
$447.00
LY415794 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 13 (SERPINB13) (as WB positive control) 100 ug
$436.00

Other products for "SERPINB13 or NM_012397"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211032
Predicted MW 44.3 kDa
Protein Sequence
Protein Sequence
>RC211032 protein sequence
Red=Cloning site Green=Tags(s)

MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKA
EEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA
ADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKS
VQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERK
VNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG
IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036529
RefSeq Size 3197
RefSeq ORF 1173
Synonyms headpin; HSHUR7SEQ; HUR7; PI13
Locus ID 5275
UniProt ID Q9UIV8
Cytogenetics 18q21.33
Summary The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein inhibits the activity of cathepsin K and is itself transcriptionally repressed by RUNX1. This gene is downregulated in many types of cancer. provided by RefSeq, Jan 2017
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SERPINB13" proteins (3)
SKU Description Size Price
LC415794 Lyophilized SERPINB13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415794 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 13 (SERPINB13) (as WB positive control) 100 ug
$436.00
TP311032 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 13 (SERPINB13), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products