SERPINB13 (NM_012397) Human Recombinant Protein

SKU
TP311032
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 13 (SERPINB13), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211032 protein sequence
Red=Cloning site Green=Tags(s)

MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKA
EEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA
ADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKS
VQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERK
VNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG
IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036529
Locus ID 5275
UniProt ID Q9UIV8
Cytogenetics 18q21.33
RefSeq Size 3197
RefSeq ORF 1173
Synonyms headpin; HSHUR7SEQ; HUR7; PI13
Summary The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein inhibits the activity of cathepsin K and is itself transcriptionally repressed by RUNX1. This gene is downregulated in many types of cancer. [provided by RefSeq, Jan 2017]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:SERPINB13 (NM_012397) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH311032 SERPINB13 MS Standard C13 and N15-labeled recombinant protein (NP_036529) 10 ug
$3,255.00
LC415794 SERPINB13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415794 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 13 (SERPINB13) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.