STYK1 (NM_018423) Human Mass Spec Standard

CAT#: PH310846

STYK1 MS Standard C13 and N15-labeled recombinant protein (NP_060893)

Product Images

Coomassie blue staining of purified STYK1 protein (Cat# TP310846). The protein was produced from HEK293T cells transfected with STYK1 cDNA clone (Cat# RC210846) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210846
• Predicted MW: 47.5 kDa
• Protein Sequence:
  Sequence Link

  >RC210846 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSGPQGIAPVPPP
  RDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSK
  PKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYMVLEDVAQGDLLGFLWTCR
  RDVMTMDGLLYDLTEKQVYHIGKQVLLALEFLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRG
  AISSTQTIPLKWLAPERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSS
  CTHTMYSIMKSCWRWREADRPSPRELRLRLEAAIKTADDEAVLQVPELVVPELYAAVAGIRVESLFYNYS
  ML
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060893
• RefSeq Size: 3022
• RefSeq ORF: 1266
• Synonyms: NOK; SuRTK106
• Locus ID: 55359
• UniProt ID: Q6J9G0
• Cytogenetics: 12p13.2
• Summary: Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival (Liu et al., 2004 [PubMed 15150103]).[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Protein Kinase, Transmembrane