OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB9B (NM_016370) Human Mass Spec Standard

Be the first to review this product
SKU
PH310826
RAB9B MS Standard C13 and N15-labeled recombinant protein (NP_057454)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345031 Rabbit Polyclonal Anti-RAB9B Antibody - N-terminal region
100 ul
$575.00
LY413988 Transient overexpression lysate of RAB9B, member RAS oncogene family (RAB9B) (as WB positive control) 100 ug
$436.00

Other products for "RAB9B or NM_016370"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210826
Predicted MW 22.7 kDa
Protein Sequence
Protein Sequence
>RC210826 protein sequence
Red=Cloning site Green=Tags(s)

MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFK
SLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQT
WCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057454
RefSeq Size 3799
RefSeq ORF 603
Synonyms Rab-9L; RAB9L
Locus ID 51209
UniProt ID Q9NP90
Cytogenetics Xq22.2
Summary This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport. provided by RefSeq, Jan 2010
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB9B" proteins (3)
SKU Description Size Price
LC413988 Lyophilized RAB9B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413988 Transient overexpression lysate of RAB9B, member RAS oncogene family (RAB9B) (as WB positive control) 100 ug
$436.00
TP310826 Recombinant protein of human RAB9B, member RAS oncogene family (RAB9B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products