OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TXNIP (NM_006472) Human Mass Spec Standard

Be the first to review this product
SKU
PH310804
TXNIP MS Standard C13 and N15-labeled recombinant protein (NP_006463)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349090 Rabbit Polyclonal Anti-TXNIP Antibody
100 ug
$640.00
LY401945 Transient overexpression lysate of thioredoxin interacting protein (TXNIP) (as WB positive control) 100 ug
$436.00

Other products for "TXNIP or NM_006472"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210804
Predicted MW 43.7 kDa
Protein Sequence
Protein Sequence
>RC210804 protein sequence
Red=Cloning site Green=Tags(s)

MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYL
RYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETK
KNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVV
PKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYV
SVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTP
LLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006463
RefSeq Size 2979
RefSeq ORF 1173
Synonyms ARRDC6; EST01027; HHCPA78; THIF; VDUP1
Locus ID 10628
UniProt ID Q9H3M7
Cytogenetics 1q21.1
Summary This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants. provided by RefSeq, Sep 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TXNIP" proteins (3)
SKU Description Size Price
LC401945 Lyophilized TXNIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401945 Transient overexpression lysate of thioredoxin interacting protein (TXNIP) (as WB positive control) 100 ug
$436.00
TP310804 Recombinant protein of human thioredoxin interacting protein (TXNIP), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products