OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CMTM4 (NM_181521) Human Mass Spec Standard

Be the first to review this product
SKU
PH310793
CMTM4 MS Standard C13 and N15-labeled recombinant protein (NP_852662)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY405803 Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CMTM4 or NM_181521"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210793
Predicted MW 22.7 kDa
Protein Sequence
Protein Sequence
>RC210793 representing NM_181521
Red=Cloning site Green=Tags(s)

MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFI
CIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVL
AALNHRAGAEIAAVIFGFLETAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_852662
RefSeq Size 8133
RefSeq ORF 624
Synonyms CKLFSF4
Locus ID 146223
UniProt ID Q8IZR5
Cytogenetics 16q21-q22.1
Summary This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CMTM4" proteins (5)
SKU Description Size Price
LC405676 Lyophilized CMTM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405803 Lyophilized CMTM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405676 Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY405803 Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310793 Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products