OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SNX5 (NM_014426) Human Mass Spec Standard

Be the first to review this product
SKU
PH310773
SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_055241)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351736 Rabbit Polyclonal Anti-SNX5 Antibody
100 ul
$205.00
LY407705 Transient overexpression lysate of sorting nexin 5 (SNX5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SNX5 or NM_014426"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210773
Predicted MW 46.8 kDa
Protein Sequence
Protein Sequence
>RC210773 protein sequence
Red=Cloning site Green=Tags(s)

MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHE
DFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTV
SSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFE
QEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVE
GRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKF
EQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055241
RefSeq Size 2353
RefSeq ORF 1212
Locus ID 27131
UniProt ID Q9Y5X3
Cytogenetics 20p11.23
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Sep 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SNX5" proteins (7)
SKU Description Size Price
PH321829 SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_689413) 10 ug
$3,360.00
LC402334 Lyophilized SNX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407705 Lyophilized SNX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402334 Transient overexpression lysate of sorting nexin 5 (SNX5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY407705 Transient overexpression lysate of sorting nexin 5 (SNX5), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310773 Recombinant protein of human sorting nexin 5 (SNX5), transcript variant 2, 20 µg 20 ug
$867.00
TP321829 Recombinant protein of human sorting nexin 5 (SNX5), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products