SNX5 (NM_152227) Human Recombinant Protein

SKU
TP321829
Recombinant protein of human sorting nexin 5 (SNX5), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221829 protein sequence
Red=Cloning site Green=Tags(s)

MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHE
DFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTV
SSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFE
QEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVE
GRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKF
EQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_689413
Locus ID 27131
UniProt ID Q9Y5X3
Cytogenetics 20p11.23
RefSeq Size 2308
RefSeq ORF 1212
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]
Write Your Own Review
You're reviewing:SNX5 (NM_152227) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310773 SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_055241) 10 ug
$3,255.00
PH321829 SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_689413) 10 ug
$3,255.00
LC402334 SNX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407705 SNX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402334 Transient overexpression lysate of sorting nexin 5 (SNX5), transcript variant 2 100 ug
$436.00
LY407705 Transient overexpression lysate of sorting nexin 5 (SNX5), transcript variant 1 100 ug
$436.00
TP310773 Recombinant protein of human sorting nexin 5 (SNX5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.