OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAPRE1 (NM_012325) Human Mass Spec Standard

Be the first to review this product
SKU
PH310749
MAPRE1 MS Standard C13 and N15-labeled recombinant protein (NP_036457)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA378327 MAPRE1 Rabbit polyclonal Antibody
100 ul
$410.00
LY402208 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 1 (MAPRE1) (as WB positive control) 100 ug
$436.00

Other products for "MAPRE1 or NM_012325"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210749
Predicted MW 30 kDa
Protein Sequence
Protein Sequence
>RC210749 protein sequence
Red=Cloning site Green=Tags(s)

MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE
YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPS
LVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDL
EKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036457
RefSeq Size 2640
RefSeq ORF 804
Synonyms EB1
Locus ID 22919
UniProt ID Q15691
Cytogenetics 20q11.21
Summary The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAPRE1" proteins (4)
SKU Description Size Price
LC402208 Lyophilized MAPRE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402208 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 1 (MAPRE1) (as WB positive control) 100 ug
$436.00
TP310749 Recombinant protein of human microtubule-associated protein, RP/EB family, member 1 (MAPRE1), 20 µg 20 ug
$867.00
TP710361 Purified recombinant protein of human microtubule-associated protein, RP/EB family, member 1 (MAPRE1), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products