OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSPC142 (BABAM1) (NM_001033549) Human Mass Spec Standard

Be the first to review this product
SKU
PH310626
C19orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028721)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA890052 Rabbit polyclonal anti-BABAM1 Antibody
100 ul
$407.00
LY415463 Transient overexpression lysate of chromosome 19 open reading frame 62 (C19orf62), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "HSPC142 or NM_001033549"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210626
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC210626 protein sequence
Red=Cloning site Green=Tags(s)

MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGP
KSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDK
SHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYV
VRTILVYSRPPCQPQFSLTEPMKKMFQCPYFFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKY
EVALAGPALELHNCMAKLLAHPLQRPCQSHASYSLLEEEDEAIEVEATV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028721
RefSeq Size 1505
RefSeq ORF 987
Synonyms C19orf62; HSPC142; MERIT40; NBA1
Locus ID 29086
UniProt ID Q9NWV8
Cytogenetics 19p13.11
Summary Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it is required for the complex integrity and its localization at DSBs. Component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates (PubMed:24075985, PubMed:26195665). In these 2 complexes, it is probably required to maintain the stability of BABAM2 and help the 'Lys-63'-linked deubiquitinase activity mediated by BRCC3/BRCC36 component. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1 (PubMed:26195665). Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activity by enhancing its stability and cell surface expression (PubMed:24075985). Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination (PubMed:24075985).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSPC142" proteins (7)
SKU Description Size Price
PH302644 C19orf62 MS Standard C13 and N15-labeled recombinant protein (NP_054892) 10 ug
$3,360.00
LC415463 Lyophilized BABAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422382 Lyophilized BABAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415463 Transient overexpression lysate of chromosome 19 open reading frame 62 (C19orf62), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422382 Transient overexpression lysate of chromosome 19 open reading frame 62 (C19orf62), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302644 Recombinant protein of human chromosome 19 open reading frame 62 (C19orf62), transcript variant 2, 20 µg 20 ug
$867.00
TP310626 Recombinant protein of human chromosome 19 open reading frame 62 (C19orf62), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products