HSPC142 (BABAM1) (NM_001033549) Human Tagged ORF Clone

SKU
RC210626
BABAM1 (Myc-DDK-tagged)-Human BRISC and BRCA1 A complex member 1 (BABAM1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HSPC142
Synonyms C19orf62; HSPC142; MERIT40; NBA1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210626 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGTGGCAGAGCCCAGCAGCCCCACTGAAGAGGAGGAGGAGGAAGAGGAGCACTCGGCAGAGCCTC
GGCCCCGCACTCGCTCCAATCCTGAAGGGGCTGAGGACCGGGCAGTAGGGGCACAGGCCAGCGTGGGCAG
CCGCAGCGAGGGTGAGGGTGAGGCCGCCAGTGCTGATGATGGGAGCCTCAACACTTCAGGAGCCGGCCCT
AAGTCCTGGCAGGTGCCCCCGCCAGCCCCTGAGGTCCAAATTCGGACACCAAGGGTCAACTGTCCAGAGA
AAGTGATTATCTGCCTGGACCTGTCAGAGGAAATGTCACTGCCAAAGCTGGAGTCGTTCAACGGCTCCAA
AACCAACGCCCTCAATGTCTCCCAGAAGATGATTGAGATGTTCGTGCGGACAAAACACAAGATCGACAAA
AGCCACGAGTTTGCACTGGTGGTGGTGAACGATGACACGGCCTGGCTGTCTGGCCTGACCTCCGACCCCC
GCGAGCTCTGTAGCTGCCTCTATGATCTGGAGACGGCCTCCTGTTCCACCTTCAATCTGGAAGGACTTTT
CAGCCTCATCCAGCAGAAAACTGAGCTTCCGGTCACAGAGAACGTGCAGACGATTCCCCCGCCATATGTG
GTCCGCACCATCCTTGTCTACAGCCGTCCACCTTGCCAGCCCCAGTTCTCCTTGACGGAGCCCATGAAGA
AAATGTTCCAGTGCCCATATTTCTTCTTTGACGTTGTTTACATCCACAATGGCACTGAGGAGAAGGAGGA
GGAGATGAGTTGGAAGGATATGTTTGCCTTCATGGGCAGCCTGGATACCAAGGGTACCAGCTACAAGTAT
GAGGTGGCACTGGCTGGGCCAGCCCTGGAGTTGCACAACTGCATGGCGAAACTGTTGGCCCACCCCCTGC
AGCGGCCTTGCCAGAGCCATGCTTCCTACAGCCTGCTGGAGGAGGAGGATGAAGCCATTGAGGTTGAGGC
CACTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210626 protein sequence
Red=Cloning site Green=Tags(s)

MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGP
KSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDK
SHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYV
VRTILVYSRPPCQPQFSLTEPMKKMFQCPYFFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKY
EVALAGPALELHNCMAKLLAHPLQRPCQSHASYSLLEEEDEAIEVEATV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001033549
ORF Size 987 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001033549.2
RefSeq Size 1505 bp
RefSeq ORF 990 bp
Locus ID 29086
UniProt ID Q9NWV8
Cytogenetics 19p13.11
MW 36.6 kDa
Summary Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it is required for the complex integrity and its localization at DSBs. Component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates (PubMed:24075985, PubMed:26195665). In these 2 complexes, it is probably required to maintain the stability of BABAM2 and help the 'Lys-63'-linked deubiquitinase activity mediated by BRCC3/BRCC36 component. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1 (PubMed:26195665). Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activity by enhancing its stability and cell surface expression (PubMed:24075985). Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination (PubMed:24075985).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HSPC142 (BABAM1) (NM_001033549) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210626L1 Lenti ORF clone of Human BRISC and BRCA1 A complex member 1 (BABAM1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210626L2 Lenti ORF clone of Human BRISC and BRCA1 A complex member 1 (BABAM1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC210626L3 Lenti ORF clone of Human BRISC and BRCA1 A complex member 1 (BABAM1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210626L4 Lenti ORF clone of Human BRISC and BRCA1 A complex member 1 (BABAM1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG210626 BABAM1 (tGFP-tagged) - Human BRISC and BRCA1 A complex member 1 (BABAM1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC322038 BABAM1 (untagged)-Human BRISC and BRCA1 A complex member 1 (BABAM1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.